The short version of lyophilisation fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-12-19 and is reviewed periodically as new material appears.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
The main chemical liabilities of this sequence are peptide-bond hydrolysis and possible aspartate-related reactions, since the peptide contains aspartic acid residues but no cysteine, methionine, or tryptophan. Absence of those three residues removes the most common oxidation and disulfide pathways from consideration. Studies of related peptides indicate that aspartate isomerisation and aspartimide formation occur most readily at Asp-Gly and Asp-Ala positions, and open questions remain about how quickly those reactions proceed under ordinary laboratory conditions. Storage guidance typically emphasises cool, dry, dark conditions to slow hydrolysis.
BPC-157 is a synthetic pentadecapeptide, meaning it consists of fifteen amino acids joined in a single chain. Its sequence is Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, a fragment corresponding to part of a larger protein found in human gastric juice. The peptide was first described in the 1990s by researchers in Zagreb who were studying gastric protective factors. It is not a naturally circulating hormone; it is a laboratory-made fragment derived from a stomach protein. The name is an abbreviation of body protection compound, with the number referring to the fragment's position in the source protein.
Most published work on BPC-157 comes from animal experiments rather than controlled human trials. Rodent models have examined its effects on gastrointestinal lesions, tendon and ligament injury, and blood vessel formation. These studies are often small and originate from a limited number of research groups, which affects how broadly the findings can be generalized. No large randomized human trial has been reported in the peer-reviewed literature. Discussion of the compound therefore rests largely on preclinical data, and questions about its effects in people remain open rather than settled.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilised material; shade varies slightly between lots |
| Solubility in water | Freely soluble | Dissolves in water, saline, and aqueous buffers |
| Solubility in nonpolar solvents | Poorly soluble | Not compatible with oils or hydrocarbon solvents |
| Typical storage temperature | About −20 °C | Lyophilised, dry, dark storage slows hydrolysis |
| Common purity method | Reversed-phase HPLC | Area percentage, usually paired with mass spectrometry |
Most published studies examine BPC-157 in animal models rather than in humans. Common subjects include rats and mice, and researchers often use models of tissue injury, surgery, or induced inflammation. Reported endpoints include healing rates, blood vessel formation, and markers of tissue repair. These designs provide controlled comparisons, but findings in animals do not automatically transfer to people. Human clinical data remain limited and are frequently described as preliminary.
Doses in the literature are usually expressed in micrograms or nanograms per kilogram of body weight. Investigators have administered the peptide by several routes, including injection and oral delivery, depending on the question asked. Route and dose vary widely across studies, which complicates direct comparison of results. Many papers report effects at low doses, but the absence of a standardized protocol limits generalization. Reporting practice differs between research groups.
The molecule carries 15 residues, a molar mass near 1419.5 g/mol, and the formula C62H98N16O22. Its structure features a proline-rich central region, a pair of adjacent aspartic acid residues, and no cysteine. The absence of cysteine means no disulfide bonds can form, which simplifies refolding and reconstitution. Suppliers usually ship the material as a freeze-dried powder that appears white to off-white. It dissolves readily in water and in saline solutions.
Published storage guidance follows general peptide practice rather than product-specific studies. The dry powder is typically kept at minus 20 degrees Celsius, away from light and moisture. Once reconstituted, solutions are generally refrigerated and used over days to weeks, because the aqueous environment slowly promotes hydrolysis and oxidation. Long-term data on degradation rates or breakdown products are sparse. Stated shelf lives from different producers vary widely, reflecting the absence of a shared reference standard.
Arterial bypass surgery to create another source of blood supply Embolectomy, to remove the embolus, with various techniques available: Thromboaspiration Angioplasty with balloon catheterization with or without implanting a stent Balloon catheterization or open embolectomy surgery reduces mortality by nearly 50% and the need for limb amputation by approximately 35%. Embolectomy by open surgery on the artery If extensive necrosis and gangrene has set in an arm or leg, the limb may have to be amputated. Limb amputation is in itself usually remarkably well-tolerated, but is associated with substantial mortality (~50%), primarily because of the severity of the diseases in patients where it is indicated.
An insurgent was killed and eight captured in a military operation in the Greda Shah Jahan village of Bannu District, while three more alleged militants were captured from Saidu Sharif by police. Two children were injured in an insurgent mortar attack Dabar Malano Jalwaana area of Wara Mamund tehsil. On 20 July, four militants were killed in a military operation in Lakrai area of Mohmand District while six were killed in raids throughout Bannu District, six IEDs were also neutralized in Bannu District. Three Excise Department personnel were abducted from a checkpoint on the Dalbandin–Taftan Highway in Chagai District. On 21 July, a peace committee member was assassinated by an IED attack in Karrapa area of Hangu District while TTP claimed to have killed two in the Muhammad Khel area of Boya Tehsil. The Wadigram area in Salarzai Tehsil was hit by two mortar shells while insurgents blew up a Government school in Mamund Tehsil. On 22 July, a TTP insurgent was captured from the Syed Ali Mela Khor area of Kurram District while three were captured from Khyber District, three more were killed in a military operation in Chapri Naryab Chowk area of Hangu District. On 23 July, insurgents ambushed and killed a Police Constable near Moula Khan Sarai in the Sarwekai area of South Waziristan District. Four TTP militants were killed and five captured in a military operation in Talgai mountains of Wazir Tehsil, while two militant hideouts were destroyed in the Sipah Tandi Kalay area of Bara.
The clitoral hood or prepuce projects at the front of the labia commissure, where the edges of the labia majora meet at the base of the pubic mound. It is partially formed by fusion of the upper labia minora. The hood's function is to cover and protect the glans and external shaft. There is considerable variation in how much of the glans protrudes from the hood and how much is covered by it, ranging from completely covered to fully exposed, and tissue of the labia minora also encircles the base of the glans.
Sources: en.wikipedia.org
=== Pharmacokinetics === Detailed pharmacokinetic studies on arsenic trioxide have not been conducted. When administered intravenously, a steady state is reached after 8–10 days. Arsenic binds to proteins to an insignificant extent. The highest concentrations of arsenic are found in the liver, kidneys, heart, lungs, hair, and nails. Arsenous acid is oxidized to arsenic acid and methylated in the liver, and then excreted 60% in the urine. The drug has a half-life of 92 hours. Arsenic trioxide is neither a substrate nor an inhibitor of cytochrome P450 isozymes (1A2, 2A6, 2B6, 2C8, 2C9, 2C19, 2D6, 2E1, 3A4/5, 4A9/11).
The material on the presynaptic and post-synaptic membranes is denser in a Type I synapse than it is in a Type II, and the Type I synaptic cleft is wider. Finally, the active zone on a Type I synapse is larger than that on a Type II synapse. The different locations of Type I and Type II synapses divide a neuron into two zones: an excitatory dendritic tree and an inhibitory cell body. From an inhibitory perspective, excitation comes in over the dendrites and spreads to the axon hillock to trigger an action potential. If the message is to be stopped, it is best stopped by applying inhibition on the cell body, close to the axon hillock, where the action potential originates. Another way to conceptualize excitatory–inhibitory interaction is to picture excitation overcoming inhibition. If the cell body is normally in an inhibited state, the only way to generate an action potential at the axon hillock is to reduce the cell body's inhibition. In this "open the gates" strategy, the excitatory message is like a racehorse ready to run down the track, but first, the inhibitory starting gate must be removed.
=== Support for 18th Amendment === Bhutto Zardari has repeatedly criticized the historical One Unit Scheme, and warned against any attempt to bring in a presidential system, explaining that it will not be in the interest of democracy. During a press conference on 27 April 2019, he stated that the "presidential system is neither in the interest of the country nor the federation and all democratic forces will resist any such move."
Sources: en.wikipedia.org
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
== Research directions == Recently, a large body of scientific research deals with the background of autoimmune disease, the cause of many rheumatic disorders. Also, the field of osteoimmunology has emerged to further examine the interactions between the immune system, joints, and bones. Epidemiological studies and medication trials are also being conducted. The Rheumatology Research Foundation is the largest private funding source of rheumatology research and training in the United States.
== Origins == Due to the long, tedious process of analyzing proteins, peptide mass fingerprinting was developed. Edman degradation was used in protein analysis, and it required almost an hour to analyze one amino acid residue. SDS-PAGE was also used to separate proteins in very complex mixtures, which also employed methods of electroblotting and staining. Then, bands would be extracted from the gel and sequenced, automatically. A recurring problem in the process was that interfering proteins would also purify with the protein of interest. The sequences of these interfering proteins were compiled into what came to known as the Dayhoff database. Ultimately, having the sequences of these known protein contaminants in databases decreased instrument time and expenses involved in protein analysis.
At the 2015 China Victory Day Parade, Xi announced a reduction of 300,000 troops from the PLA, bringing its size to 2 million troops. Xi described this as a gesture of peace, while analysts have said that the cut was done to reduce costs as well as to modernize the PLA. In November 2015, the Central Leading Group for Military Reform announced extensive reforms in the PLA called Deepening National Defense and Military Reform. In 2016, Xi reduced the number of theater commands of the PLA from seven to five. He also abolished the four autonomous general departments of the PLA, replacing them with 15 agencies directly reporting to the CMC. Two new branches of the PLA were created under his reforms, the Strategic Support Force and the Joint Logistics Support Force. PLA Second Artillery Corps was upgraded to the PLA Rocket Force. In March 2016, the CMC announced the abolishment of paid services by the PLA and the People's Armed Police (PAP) by 2019, meaning activities like military-run hospitals and hotels open to the public. On 21 April 2016, Xi was named commander-in-chief of the country's new CMC Joint Operations Command Center. In 2018, the PAP was placed under the sole control of the CMC; it was previously under the joint command of the CMC and the State Council through the Ministry of Public Security. The PLA went through further extensive reforms in 2024; the Strategic Support Force was dissolved and the Aerospace Force, the Cyberspace Force and the Information Support Force was established as arms of the PLA, joining the Joint Logistics Support Force.
Sources: en.wikipedia.org
Lyophilised peptide powders are generally kept frozen or refrigerated, dry, and protected from light. Sealed vials limit moisture uptake and slow hydrolysis. Such guidance comes from general peptide chemistry rather than from stability studies specific to every product.
Reversed-phase HPLC is the standard approach, with purity expressed as a percentage of total peak area. Mass spectrometry confirms the expected molecular mass and can reveal adducts or truncated sequences. Neither method on its own establishes biological activity.
Small mass differences often reflect different counterions, such as acetate versus trifluoroacetate, or bound water rather than a different amino acid sequence. Mass spectrometry can distinguish these forms when the ionisation conditions are known. Exact sequence confirmation requires peptide mapping or tandem mass spectrometry.
It is a chain of fifteen amino acids, referred to as a pentadecapeptide. The sequence is Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. It corresponds to a fragment of a protein found in human gastric juice.